SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087I5P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087I5P7
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.33e-33
Family Ribosomal proteins L24p and L21e 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087I5P7
Sequence length 105
Comment (tr|A0A087I5P7|A0A087I5P7_VIBVL) 50S ribosomal protein L24 {ECO:0000256|HAMAP-Rule:MF_01326} KW=Complete proteome OX=672 OS=Vibrio vulnificus. GN=COO31_015120 OC=Vibrionaceae; Vibrio.
Sequence
MAAKIRRNDEVIVLAGKDKGKKGKVTKVLATGKVVVEGINLVKKHQKPVPALGIQGGIVE
QEAAIDVSNVAIFNAATGKADRIGFRFEDGQKVRFFKSNGETVSN
Download sequence
Identical sequences A0A087I5P7
WP_017420317.1.13374 WP_017420317.1.22486 WP_017420317.1.24453 WP_017420317.1.28215 WP_017420317.1.28571 WP_017420317.1.30871 WP_017420317.1.31968 WP_017420317.1.39524 WP_017420317.1.43691 WP_017420317.1.47396 WP_017420317.1.49981 WP_017420317.1.512 WP_017420317.1.53782 WP_017420317.1.54603 WP_017420317.1.553 WP_017420317.1.58875 WP_017420317.1.59048 WP_017420317.1.59451 WP_017420317.1.60167 WP_017420317.1.60868 WP_017420317.1.61535 WP_017420317.1.63462 WP_017420317.1.63825 WP_017420317.1.65015 WP_017420317.1.66219 WP_017420317.1.67868 WP_017420317.1.73173 WP_017420317.1.78668 WP_017420317.1.81555 WP_017420317.1.82587 WP_017420317.1.84562 WP_017420317.1.86005 WP_017420317.1.86748 WP_017420317.1.95941 WP_017420317.1.96968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]