SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087KNJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087KNJ4
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.07e-27
Family Chaperone J-domain 0.00028
Further Details:      
 
Domain Number 2 Region: 202-285
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000144
Family HSP40/DnaJ peptide-binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 113-207
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000379
Family HSP40/DnaJ peptide-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087KNJ4
Sequence length 304
Comment (tr|A0A087KNJ4|A0A087KNJ4_9GAMM) DNA-binding protein {ECO:0000313|EMBL:KFK93946.1} KW=Complete proteome; Reference proteome OX=1524467 OS=Serratia sp. Ag1. GN=IV04_23225 OC=Yersiniaceae; Serratia.
Sequence
MEIKDYYAILGVKPSDDIKAIKTAYRRLARKFHPDVSTEKDAEARFKDVAEAYEVLKDSE
RRAQYDQLLQQRNNPDFGRQTQYTEQGNAEDFADIFSSMFGRGAQGRQPRHAARGQDLEL
SVAMFLEETLSEQTRSLSYTVPVYNIFGLVEKEIPKTLNVKIPAGVGEGERIRVKGQGVP
GTDGGANGDLYLIIKLAPHPLFEVIGHDLEIVVPLAPWEAALGTKISLPTLSDNILLTIP
AGSQAGQRLRLKGKGLVSKKETGNLYAVIKIVMPAKPDEKQAALWQQLAEANTAFDPRTV
WRKA
Download sequence
Identical sequences A0A087KNJ4
WP_037404528.1.14148 WP_037404528.1.50496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]