SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087KSW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087KSW5
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-35
Family SMI1/KNR4-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087KSW5
Sequence length 139
Comment (tr|A0A087KSW5|A0A087KSW5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KFK95467.1} KW=Complete proteome; Reference proteome OX=1524467 OS=Serratia sp. Ag1. GN=IV04_20975 OC=Yersiniaceae; Serratia.
Sequence
MSSELDRVINELKMLSGGESLNVDLPDDALITRYEKDIGFTFPEDYKKALKEVSNVFYGT
VELLSVTKDGNYYGELAQALRDARDQGLPEDWLPICEDNGSYYCLVPNGQVRYWTTDGYS
DEKWPDLASWIKQVWIESN
Download sequence
Identical sequences A0A087KSW5
WP_037404482.1.14148 WP_037404482.1.50496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]