SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087NLF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087NLF1
Domain Number 1 Region: 129-194
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000255
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087NLF1
Sequence length 197
Comment (tr|A0A087NLF1|A0A087NLF1_BURPY) Cell wall assembly protein {ECO:0000313|EMBL:KFL49954.1} KW=Complete proteome OX=60550 OS=Burkholderia pyrrocinia (Pseudomonas pyrrocinia). GN=JM78_32235 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MTLVDTYLAGLRAALPDADNAALAAATGAMPAQLDALRAAYPQCPASLLELLGKLDGTYW
RDYGGTTINVLVLGSDVYEYPYYLLSAEQMLDEAAKYRDSIADIYGDDANDDGELVDPRI
DIALPMSRRLCFSHCMNNGGTSQLYIDFDPAPGGKVGQVVRFLHDPDSYAVIADDFDGYL
RQLIDGGYAFVIDFDEE
Download sequence
Identical sequences A0A087NLF1
WP_034184512.1.17605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]