SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087NY98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087NY98
Domain Number 1 Region: 26-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000288
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087NY98
Sequence length 193
Comment (tr|A0A087NY98|A0A087NY98_BURPY) Uncharacterized protein {ECO:0000313|EMBL:KFL54101.1} KW=Complete proteome OX=60550 OS=Burkholderia pyrrocinia (Pseudomonas pyrrocinia). GN=JM78_11380 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MKGADIGSGDDVMMDKLSQLGATPIDLLSKTKMQILAALEVKVGRLQDDYRNLLLHFGGD
IEFSSLIKFRADESSLWAAEDGTESLEILYGLKSKYGSSILQMFETYKGRIPEDWIPIGE
APGGNQICLRIHPSDGFQSVEFWNHDSEVGPGLPPSGDGLTKIANSLRDFVNRLTPEDPP
ENIPRAVEVDLQF
Download sequence
Identical sequences A0A087NY98
WP_051983685.1.17605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]