SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087QIM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087QIM7
Domain Number 1 Region: 521-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000114
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1170-1227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 105-152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 925-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 587-655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 1292-1356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 259-311
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000602
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 977-1047
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000127
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 661-714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 1053-1101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 1226-1275
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087QIM7
Sequence length 1532
Comment (tr|A0A087QIM7|A0A087QIM7_APTFO) Thrombospondin type-1 domain-containing protein 7B {ECO:0000313|EMBL:KFM01081.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_00534 OC=Aptenodytes.
Sequence
GWTTYHANCDQKDKPESQRRCFKVCDWHLELFEWEVSGWDRCGLVPFAGGEVRPGACVTA
QHGLQRRSVRCLQKLNRTVVANEICEYFMPQPPAEQACLVPCPRDCVVSEFSSWSECGTG
CTKSLQHRTRAVIAPPLYGGAPCPNLTESRACGAPPCPLGEEEHTYSLRVGSWGECRLPH
PKDVDLAGRTMPDFGSDSGERSTSGLQGYKPHHRPGEVEIGYQTRQVRCVRSDGKNAVLS
LCVQDPVPLTFKSCVIAKDCETSEWSSWSACSRTCGWGDLTPGFRSRRRGVRSVAVGAGK
QCPELEEREACSVGGKELLQPCPRFAWRTSEWKACQVSLLLDQQDPRRHKHVGLCGGGIQ
TREVYCVQITVEIGMHRLKEVTRPVDGKLCLGPAPSASQLCNLPCPSECVVSAWSVWGPC
LHENCQDLQGRRGFRMRQRQVIVEPVGTLAGCPHLIESIPCEDPMCYEWIVSEGICVTHH
GKCGPGNRILKAVCKNKRGEEVPHRLCSELPRPEVVACEIPCAMDCVISEWSPWSPCSHS
CSSKNAEGSQSRSRSILALPAEAGKACPPDRALQEHRACNGHPCVHFFWETSPWSSCSED
TPVTALNATINWSGEATCGVGIQTRKVFCIKSSSGQVTPKRCPESIRPETVRPCLLLCKK
DCIVTPFSEWTRCPTACQPGNATAVKQSRYRIVVQDAANGGQACPDTLYEERECEDIPIC
PVYRWKTHRWSHCVLVPDSVRQGVPGHSEACGHGLQSRAVTCLSEYNDSADVGDCMQWAG
AMPSLVQECLVPCKDDCTFTPWSKFTACSFDCESTRSRRRSLTGRSRKRDKCQDTEVYPQ
VETELCPCEVFTSQPHGNWSDCIIGGGTSEPQLGTRSHGDVKECGEGVRLRAIACYDKTG
RLVEPSRCSSSGYIEESCTVPCPFDCKLSDWSSWSRCSSSCGPGVKVRSKWLKEKPYNGG
RPCPKLDLKNQVYEAVPCYSECNQYSWVVEPWSPCKINSEQNSLHCGEGIQTRRVRCVST
VEDHGGETVPNALCNQAEIPDIMQKCSLYCPSECAVSDWGQWSKCPQVCDPNVMQTRTRQ
VLRSSINTKPCPEDSQMKPCILNQNCFQYQYNLTGWSGCQLGANATCGHGERRRLLSCRR
SDGATVSTQLCQRLRLEKPVQTSSRCVVGCTVDCQLSAWSAWSQCSHTCGAGGQMVRGRS
VVLRAAGEGRPCPEQLTQHRSCPVKPCYSWLLGPWSPCKVQGGQCGDGLQVRNLTCVVYD
ASVSATSKPVENALCGELPSRESVLQLPCSVPCPGDCHLTEWSEWSSCELTCINGRSFET
MGRQSRSRAFIVQSPENQESCFGQAMETRPCSGGECYDYLWKTSLWRDNVRTVWCQRSDG
INVTGGCALQTKPAEVRHCSPACRKPFSYCTQRGVCGCERGYTEIMRSNGFLDYCMKVPG
LEDKKADVKTIAGKNKPVNSKMHDIFKGWSIQPFNPDGKLKMWVYGVSAGGFLIIVFLIF
TSYLMCKKAKQHQSTPPQQKPLTLAYDGDIDM
Download sequence
Identical sequences A0A087QIM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]