SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087QRV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087QRV3
Domain Number 1 Region: 53-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 2 Region: 117-188
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000502
Family Fibronectin type I module 0.076
Further Details:      
 
Domain Number 3 Region: 215-260
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000549
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087QRV3
Sequence length 368
Comment (tr|A0A087QRV3|A0A087QRV3_APTFO) WNT1-inducible-signaling pathway protein 1 {ECO:0000313|EMBL:KFM03957.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_05662 OC=Aptenodytes.
Sequence
MRWLLPWILAASSILQVSLETAGETRLLQTHLHLMHGGLGEPKAYTRTQYCKWPCECPKS
PPRCSVGVSLVTDGCDCCKMCAKQRGESCTEADTCDFHRGLYCDYSGDRPRYEIGVCAQI
VGVGCVLNGVRYKNGDTFQPNCKYNCTCINGAVGCIPMCTNSRPPLVWCPNPKLIKMAGK
CCEQWICDDSKKIRKTSPRHISSAAYEGEDEAWQKNCIVHTSSWSPCSKTCGLGISTRIS
NDNDQCRLLKESRLCNMRPCEVDITTHIKPGKKCLAVYRANEPMNYTISGCVSKSPYRPK
YCGVCTDNRCCTPYKSKTIEVRFECPDGTEFSWKIMWINACFCNLNCKNPNDIFADLAHY
HDYSEIPN
Download sequence
Identical sequences A0A087QRV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]