SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087QS15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087QS15
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000575
Family Prefoldin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087QS15
Sequence length 127
Comment (tr|A0A087QS15|A0A087QS15_APTFO) Prefoldin subunit 4 {ECO:0000313|EMBL:KFM04019.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_03224 OC=Aptenodytes.
Sequence
AAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMMLDDGDSLLI
PYQIGDVFISHSQEETQEMLEEAKKSLQEEIEVLESRVESIQRVLSDLKVQLYAKFGNNI
NLEAEDS
Download sequence
Identical sequences A0A087QS15 A0A091SJS5 A0A093NW97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]