SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087R272 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087R272
Domain Number 1 Region: 175-377
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-47
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 469-524
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000301
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 888-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000497
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 827-885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 764-823
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087R272
Sequence length 1008
Comment (tr|A0A087R272|A0A087R272_APTFO) A disintegrin and metalloproteinase with thrombospondin motifs 3 {ECO:0000313|EMBL:KFM07576.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_10819 OC=Aptenodytes.
Sequence
LYFNVTAFGREFHLRLKPNTRLVAPEAVVEWYEDSLETGNDAGNTTRTRTATERLWRREP
LWTNCAYVGDITDIPGASVAISNCDGLAGMIRTDKDEYFIEPLERGKQMEEEKGRIHMVY
RRSAVVQHPTDTLPDVHTEESLLGGLGGLSSLYSGVEQQLNKTLRRRRHAGGDDYNIEVL
LGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVHINVVLVRMIMLGYAKSISLIE
RGNPSRSLENVCRWAYQQQKSDPNHSEHHDHAIFLTRQDFGPAGMQGYAPVTGMCHPVRS
CTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRC
SGQELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTFDP
CKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCYKGHCMWKNANQLKQDGNWGPWTKFG
SCSRTCGTGVRFRTRQCNNPMPINGGEDCAGVNFEFQLCNTEECPKHFEDFRAQQCQQRN
SHFEYQSSKHHWLPYEHPDPNKRCHLYCQSKETGDVAYMKQLAHDGTRCSYKDPYSICVR
GECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFTRTPKKLGYLKMFDIPPGARHV
FIQEDEASPHFLAIKNQATGHYILNGKGEEARSRSFIDLGVEWEYNIEDDIETLHTDGPL
HDAVVVLIIPRENDTRSSLTYKYIIHEDSVPTINSNNVLQEEIDTFEWALKSWSQCSKPC
GGGFQYTKYGCRRKSDNKMVHRSFCEASKKPKPIRRMCNLQECTQPLWAADEWEYCTKTC
GNSGYQIRTVRCIQPLHDGANRSVHFKYCSGDRPESRRPCNRVPCPAQWKAGPWSECSVT
CGEGTETRQIMCRAGDRCDGEKPESVRVCKLAPCNVTGLSPPWERDGFGWDTTLKSTVCF
EGPCRRLGEDEPCMGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSS
Download sequence
Identical sequences A0A087R272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]