SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087R4E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087R4E0
Domain Number 1 Region: 180-274
Classification Level Classification E-value
Superfamily Immunoglobulin 9.87e-16
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 28-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 103-174
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000255
Family Pre-dockerin domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087R4E0
Sequence length 1019
Comment (tr|A0A087R4E0|A0A087R4E0_APTFO) Cartilage intermediate layer protein 1 {ECO:0000313|EMBL:KFM08344.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_15001 OC=Aptenodytes.
Sequence
GTRSSSRHRDPTFAYTRRSPLVQDSKQFLSPWSKWSECSGKCGQTGVQKRTRSCLAERLW
GTHCNEATEEGRLCIGHVCSACNITCPMGRVNADCDTCMCEDATLHGKVSLEDGSPAADA
RVYLQAKKLKLLTTANNRGMFRIPGVCPDGKNTLKIKKAKYATATVTMPESNRRNLAIQV
QLQRSGKPYIFRSPKDKARRVGESVSLCCDALGSPAPDRYLWYHNGSLLDPSLYKYKNNL
ILKNLNRDQSGEYFCKASSAGGSAKSQSAKLAVIGRQEAACDSQPQSHLIRLPHDCFQKA
TNSFYYDVGKCPAKTCAGKLDKGLRCKDNVAYCCGVSKMETRDISCNGYTLPTKVVIECG
CKKCIETKITVRGRATAADNGEPLRFGHIYMGNKRVSMTGYKGTFSIHIPADTERLVLTF
VDRLQKFVNTTKVLPFKENGGAVFHEIKLLRKKAPVMLESTETNVISLGEMEEDDPIAEL
EIPPNAFYRKNGEAYRGKVKASVTFLDPRNISTAPVTQSDLNFVEEEGDVFPLRTYGMFS
VDFTDEQGTESLNAEEVKVHLDAAQVKMPEHLQEMKLWSLNPETGLWEEEGDFNLEKSRR
HKREERTFLVGNMEIKERRLFNLDVPESRRCYIKVRAYRSERFLQSEQIQGVVISVINTE
PEPGFSSNPRAWGRFDSVVTGPNGACVPAFCDEQNPEAYAAYILASLGGEELEAVSSAPK
LNPNAIGVPQPYLNKLNYRRTDHEDSSTKKTAFSINMAKPSPNSPEENNGPIYAYENLRE
CEEAPQSAAHFRFYRIEGDQYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYIKVKIN
GPQEVNVRSRNMGGTHPRTIGRLYGIRDVRSIRDSKQPDVSAACLEFKCSGMLFDQDRVD
RTLVKVVPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGIYTVTD
QDPRIAKEIALGRCFDGTSDGTSRTMKSNIGVGLTFTCSERSAAEQSIFQSQRNSGQQS
Download sequence
Identical sequences A0A087R4E0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]