SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RFJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RFJ5
Domain Number 1 Region: 224-435
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.15e-58
Family Reprolysin-like 0.00071
Further Details:      
 
Domain Number 2 Region: 523-579
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1173-1232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1327-1384
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 928-990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 990-1045
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 1123-1176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 8 Region: 1272-1328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000101
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 1041-1103
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 1389-1443
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 1626-1665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 12 Region: 1440-1499
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000916
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 13 Region: 1561-1608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 14 Region: 1494-1554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 15 Region: 817-869
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000785
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087RFJ5
Sequence length 1881
Comment (tr|A0A087RFJ5|A0A087RFJ5_APTFO) A disintegrin and metalloproteinase with thrombospondin motifs 20 {ECO:0000313|EMBL:KFM12249.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_00328 OC=Aptenodytes.
Sequence
ETLVKQLSSYEIVTPVRVNEFGEAFPHTHHFSRRKRSLEAPLEPTAFRTHYQLSAYGQVF
QLNLSADAGFVAAQYTVVHVGAPQKQSSPDLRHCFYRGHVNAQEMHMAVFSICGGLMGTF
KAHDGEYFLEPLMKADGGEHEGEHNKPHLIYRHEELKKKYQKSHKPCEVSDKELKSSTVL
HPTFSSLKEESNVLQKSLSLEYALNNLSLEDGGNAHSRKKRFLSYPRYVEVMVTADTKMV
RHHGQNLQHYILTLMSIVAAIYKDSCIGNLINIVIVKLIVIHNEQEGPAITFNAATTLRN
FCLWQQAQNTLDDAHPSHHDTAVLITREDICRAREKCDTLGLAELGTMCDPLRSCSISEE
NGLSAAFTIAHELGHVFNVPHDDSFKCKEAGIKHQYHVMAPTLNYHTSPWTWSKCSQKYI
TEFLDTGYGECLLDKPSGRIYDLSSQLPGSMYDVNKQCELMFGLGSQVCPYLKQCKRLWC
TSTEGVHKGCRTQHMPLADGTVCGVGMHCRHGICVSREMETRPVDGEWGPWGPYSSCSRT
CGGGIKSTTRLCNRPEPRNGGKYCVGRRMKFRSCNTDSCPKGKKDFREQQCSEFDGKHFN
INGLTSAVRWLPKYSGISMKDRCKLFCRVSGTTSYYQLKDRVADGTPCGAETNDLCVQGL
CRQAGCDHVLNSKARRKICGICGGDNSSCKTLAGTFNSARYGYNVVVNIPKGATNIDIRQ
HSYSGKPEDDNYLALSDIHGNFILNGNFVVSMSKREINIQGAIFEYSGSNNTIERINSTD
RIEEELTLQVLCVGNLYNPDVHYSFNIPIEDRTDLFTWDPYGPWQDCSRMCQGIRRRRMT
CIRKSDHVVVSDQRCELTPTVSDVFEECNTECELRWHNVGKSDCTSKCGPGYRSIEIHCM
KYSLSKGLSAPVDDKYCADQQKPPTREPCHGDCMLTSWHYTEWSECSRSCERGVRTREAF
CMNNLGRHLPDRECQEIPRVVTQSCNEFLCPGWSVSEWSECPVTCGKGMKHRQVWCQLND
EQLRDDFCNPNDRPDSITPCELHECASWQVGPWGSCAVTCGRGYQMRAVKCVTGTYRVIL
DDDRECNAATRPRDNQECELPSCPENTKLWTTSLPLVQVGKVTQWRYGSWTPCSASCGKG
DRARYVSCRDAYGGIADESFCAHLPRPAEISSCFTPCGEWQVGNWSPCTVTCDSGIVTRQ
VICVNYHQQINENYCDPEGQPSKEQECNMPPCPPVYRHIPKIHDHPSHFPEIGYLPISHP
QDNINQWNRPSVGGYQWRTGPWGACSSTCAGGFHRRVVVCQDEEGRSASYCDEATKPPES
RHCDSGPCPRWNYGNWGECTQTCGDGIKTRLVICQLPTGQMLGDQNCEILDKPPNMAQCN
VHSCPGDVSWHRGPWKSCSVSCGKGLKFRDVHCFNSFQAKIEEGNCRHLKKPRTYKICRA
GRCPAWKASRWKECSVSCGVGIQQRDISCQLKGLGQVSEAVCNRDTRPTSKRHCWLPACM
QYQWLADEWEDCSVSYRRKEIYRKVKCVDENQLQVDESFCDPATKPPSAKNCRIAPSKYV
VLTGELSQCSASCGFGYRQRITYCVGIHSVQNEHAHGLRTVAYRECPVEPSPYIYKCNIK
GCSQAATWRVGKWTECSVSCGVGVKERTVECMTESGLSSDLCLPRLKPDARKICHEEECE
IFTTCKDIQLKKGMRKDGEYLLNIKGRMIKIYCSGMHLENPKEYLTLVKSEADNFSEVYG
FRLQNPYECPFNGSRRQDCACRNDYLAAGFTVFSKIRFDVASMQIKTTDFLFAQTILGRA
VPFATAGDCYSAARCPQGQFSINLAGTGLRLSSTVRWIAQGNYATADIHKSHDGTKIYGR
CGGFCGKCIPNTLIGLQLQIQ
Download sequence
Identical sequences A0A087RFJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]