SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RGH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RGH0
Domain Number 1 Region: 161-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-75
Family Protein kinases, catalytic subunit 0.00000152
Further Details:      
 
Domain Number 2 Region: 34-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-33
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087RGH0
Sequence length 551
Comment (tr|A0A087RGH0|A0A087RGH0_APTFO) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_04135 OC=Aptenodytes.
Sequence
MCDMGGLDNLIANTAYLQARKSGDGDTREMQKKRKSLSLPNIDQCREARQSVVADYDSIC
EQQPIGKKFFRNFLDTVPEYLVARDFLDEVLNWELAEDTVKSSTVENMITNFLKAGSKNY
LAFMSSDLASKCQAATAKDYENVVQLAKEETKLFLKDKPFQDFQTSPFYDKFIQWKVFEK
QPVTEKYFYEFRVLGKGGFGEVCAIQVKNTGKMYACKKLDKKRLKKKGGEKMALLEKEIL
EKVNSPFIVTLAYAYESKTHLCLVMSLMNGGDLKFHIYNVGERGLEMNRVIYYSAQITCG
ILHLHSIKIVYRDMKPENVLLDDNGNCRLSDLGLAVRVKEGKSITQRAGTNGYMAPEILK
EEDYSYPVDWFAMGCSIYEMVAGRTPFKDFKEKVGKDEVKRRTLEDEVTFEHDNFTEEAK
DICRLFLAKKTENRLGSRNEDDDPRKHSFFKTINFHRLEANLIDPPFVPDPSVVYAKDIA
DIADFSEIRGIEFDDKDKKFFKKFATGAVPIAWQEEIIETGLFEELNDPNRVDSGGHANG
GEAKSGVCLLL
Download sequence
Identical sequences A0A087RGH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]