SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RJA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RJA7
Domain Number 1 Region: 82-204
Classification Level Classification E-value
Superfamily Cyclin-like 2.13e-36
Family Cyclin 0.00000158
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Cyclin-like 2.46e-26
Family Cyclin 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087RJA7
Sequence length 242
Comment (tr|A0A087RJA7|A0A087RJA7_APTFO) Cyclin-H {ECO:0000313|EMBL:KFM13561.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_10260 OC=Aptenodytes.
Sequence
GTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSAQFVGNLRESPLGQEKAL
EQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEVLRKTADDFLSRVAL
TDAYLLFTPSQIALTAILSSGSRAGINMESYLSESLMLKEDRTSLAKLLDGMKCMKNLIK
KYELPRPEEVAALKQKLEKCHSSELSLNTNPKKRKGYEDDDYVAKKSKMDEEEWTDDDLV
DS
Download sequence
Identical sequences A0A087RJA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]