SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RLI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RLI6
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.23e-22
Family Ribosomal proteins L24p and L21e 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087RLI6
Sequence length 99
Comment (tr|A0A087RLI6|A0A087RLI6_9ARCH) 50S ribosomal protein L21e {ECO:0000256|HAMAP-Rule:MF_00369, ECO:0000256|SAAS:SAAS00672768} OX=1502294 OS=Marine Group I thaumarchaeote SCGC AAA799-O18. GN=AAA799O18_00604 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MTTKKPTGRSHGFKHKSRSIMTKDAPRGVSFLLREYHEGDKALVIIDPRQHKGLPHRRYH
GKVGTVNKVSRRSVTLDIKLGNKTKTLITRFDHIKPFGV
Download sequence
Identical sequences A0A087RLI6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]