SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RRG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RRG1
Domain Number 1 Region: 85-176
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 5.23e-29
Family tRNA-intron endonuclease catalytic domain-like 0.00078
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.000000000000108
Family tRNA-intron endonuclease N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087RRG1
Sequence length 178
Comment (tr|A0A087RRG1|A0A087RRG1_9ARCH) tRNA-splicing endonuclease protein {ECO:0000313|EMBL:KFM16065.1} KW=Complete proteome OX=1502291 OS=Marine Group I thaumarchaeote SCGC AAA799-D11. GN=AAA799D11_00864 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MKGELIENRVIVWNIEDSRKLFSGGYYGKPIGIPKPKIEEIDAPLVLDLIESLYLLEHKK
ITISKSKRKVTVEQMIEICKNEHHDFDKKYLVYKNFRDKGYIINPGIKFGCDFAVYEKGP
GIDHAPFLIQVYNRNEPITSTGIVLAGRLATSVKKQFILAIPKGKDNVDFLALDWWKA
Download sequence
Identical sequences A0A081RNA6 A0A081S6R9 A0A087RRG1 A0A087RWE8 A0A087S6N1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]