SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087S5G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087S5G4
Domain Number 1 Region: 41-125
Classification Level Classification E-value
Superfamily Cyclin-like 1.75e-17
Family Transcription factor IIB (TFIIB), core domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000156
Family Transcription factor IIB (TFIIB), core domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087S5G4
Sequence length 132
Comment (tr|A0A087S5G4|A0A087S5G4_9ARCH) Transcription initiation factor IIB protein {ECO:0000313|EMBL:KFM20968.1} KW=Complete proteome OX=1502289 OS=Marine Group I thaumarchaeote SCGC AAA799-B03. GN=AAA799B03_01453 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
CRISGTHRTLKDMQKVSGVNRRNLTKYYRLLIKEFNWQIPVVDPTQCVVRIANNAGVSEK
TKRTAIDILHKVKQQGFIDGKDPTSVAAAAIYIAGKKTKEVLSFKKIGSAANITELTIRN
VRKRLEILVENS
Download sequence
Identical sequences A0A087S5G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]