SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087S9L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087S9L8
Domain Number 1 Region: 304-590
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-118
Family Enolase 0.0000000221
Further Details:      
 
Domain Number 2 Region: 167-302
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.27e-57
Family Enolase N-terminal domain-like 0.0000025
Further Details:      
 
Domain Number 3 Region: 30-124
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000602
Family Multidrug resistance efflux transporter EmrE 0.0072
Further Details:      
 
Domain Number 4 Region: 123-160
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087S9L8
Sequence length 595
Comment (tr|A0A087S9L8|A0A087S9L8_AUXPR) Enolase {ECO:0000313|EMBL:KFM22422.1} KW=Complete proteome; Reference proteome OX=3075 OS=protothecoides). GN=F751_0169 OC=Chlorellaceae; Auxenochlorella.
Sequence
MPGPEMEMPEPASTEPFKWTAGKIVLSIFLFLVASVAEIGGGWLWWQTLRESKPWWLAVL
GSGVLILYGVIPTFQPTDNFGRIYAVYGGFFIIMSYLWGWAIDKQRPDTGDWIGTAIALA
GSAAAYIEEHNIQKVVEEVINATIKAKPSNPFSFMADEVRKQAPAAITAVHARQIYDSRG
NPTVEAEVTTSLGVFRAAVPSGASTGVHEAVEMRDGDKSKYMGKGVLTAVANVNDKIAPA
VIGLDPREQEKVDQTMRDLDGTPNKANLGANAILAVSLAVARAGAAEKGVPLYKHIADLA
GNTKLVLPVPSFNIINGGCHAGNALAFQEFMIMPVGASSFAEAMQVYHHLKSIIKKEYGL
DAGNVGDEGGFAPPIQSTIAGLELVVKAIEAAGHTGKIKIAMDAAASEFYDEKSQTYDLA
FKSEPNDGSQRKSQEEIRAFYKELATSYPIISIEDPFDQDDWETYAALTADLDVQIVGDD
LLCTNPVRVQKAIDTKACNALLLKVNQIGSVTESIQAVNLSKSAGFGVMTSHRSGETEDT
FIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGESWRFIANA
Download sequence
Identical sequences A0A087S9L8
XP_011399343.1.37273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]