SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087SHF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087SHF9
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily HMG-box 0.0000000406
Family HMG-box 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087SHF9
Sequence length 109
Comment (tr|A0A087SHF9|A0A087SHF9_AUXPR) Uncharacterized protein {ECO:0000313|EMBL:KFM25163.1} KW=Complete proteome; Reference proteome OX=3075 OS=protothecoides). GN=F751_6118 OC=Chlorellaceae; Auxenochlorella.
Sequence
MFGRLYCAARYGSRGGPYVGCCQEPILAAGAEAASPSAAAGEGGAEAEEPAGPSTPPRPK
SAFFYYLEAFKDQWRAEHPRATPQVKTLSQLASVSWRAMTGRDPETPTC
Download sequence
Identical sequences A0A087SHF9
XP_011398054.1.37273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]