SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087SIQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087SIQ6
Domain Number 1 Region: 99-207
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.14e-22
Family Elongation factor TFIIS domain 2 0.0022
Further Details:      
 
Domain Number 2 Region: 231-275
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.76e-19
Family Transcriptional factor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 17-87
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000249
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087SIQ6
Sequence length 277
Comment (tr|A0A087SIQ6|A0A087SIQ6_AUXPR) Transcription elongation factor A protein 2 {ECO:0000313|EMBL:KFM25610.1} KW=Complete proteome; Reference proteome OX=3075 OS=protothecoides). GN=F751_2452 OC=Chlorellaceae; Auxenochlorella.
Sequence
MLDLVKSALDASKELEAHPSGPTEPALQALEALQARRVTAAQLASSQAGKLLRPLLKHAS
PAVSQAAASVIAAWKECVRREAEEGRATGCGGGSMATPAPVPSTGDKVRDLCRTTFAAAL
CLAVEELRAAPSPDEEACATPGALAVAMEEELRRQHGGVTEGYKAKFRSLSFNLKDRKNP
DLRRKVLTGRIAPDLLVTLAPEALASDAQREENARIREKKLFDSAPSAAKQPTTDQFQCG
KCRQRKTTYYQMQTRSADEPMTTFVTCLNCNNRWKFC
Download sequence
Identical sequences A0A087SIQ6
XP_011398506.1.37273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]