SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087SQ40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087SQ40
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000014
Family SNARE fusion complex 0.00097
Further Details:      
 
Domain Number 2 Region: 175-235
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000036
Family SNARE fusion complex 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087SQ40
Sequence length 235
Comment (tr|A0A087SQ40|A0A087SQ40_AUXPR) Synaptosomal-associated protein 25 {ECO:0000313|EMBL:KFM27844.1} KW=Complete proteome; Reference proteome OX=3075 OS=protothecoides). GN=F751_5409 OC=Chlorellaceae; Auxenochlorella.
Sequence
MAKREHRDTTAAAKRAAQIADETVDAGRNTLVEIHRQGEQLDHIERGLDHMEEDVKEASS
LVKFMRRWCCWQLCCCCLDPEHKKGRPSRQQRLKMRGVTSLDHREEVANKHMSAAAAVDR
LIKRDDVAYNGDETGQRSELFQTAEAIRSERKTTSIGFGKFPGMAESDRSELDSETLKQE
GYLDSIGKAVESMKALGQEMSNELQVQDTQIERLPTRAVKVNDDLNRLNKTIAKI
Download sequence
Identical sequences A0A087SQ40
XP_011400833.1.37273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]