SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087SVQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087SVQ8
Domain Number 1 Region: 405-465
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000241
Family VWC domain 0.055
Further Details:      
 
Domain Number 2 Region: 497-540
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000146
Family Fibronectin type I module 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087SVQ8
Sequence length 554
Comment (tr|A0A087SVQ8|A0A087SVQ8_9ARAC) Uncharacterized protein {ECO:0000313|EMBL:KFM56947.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_24877 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MPSAVATTKNISSTDIKEYEISSKLPTDVVTEEIIDSLKTTMSEEEESISSFAGTSSETT
TQKTLIEERLPTEESHSESYIDEKRTGSTTEEFQDNAFLGIQTTTEKDANINVKEVETKV
TEIISSGSPAEIEEKYEFSTSSYDNDTNLDFTQSSETGDITELKVTEIVHEISTDTSALF
SVTDTSSRITETSTNPTLPVRGFEPEENETNSQIGGSAVHITAKPIKDYVLQENLTEEAV
TTPFSQNTAFDSSEPGTTVKHSELLSTVVSHLTESTLSDTETTRAANISDESSLILQLND
SSSESPHTFGTEEITSFINTDFPEEDKHRSPEVSNVTSSQTDQGTKAPFTTPVHTELLET
VSEIFGQSSPISIISETHGSFESQYSTPSSGFDQDDSQHPLQEEGICFYEGHIFQSAKQI
PRRDPCEFCFCFRGDIICLQQSCPPPIRDCFATPIQGFCCPRFHCPVQEMHFNLSTTTTT
TAKPRLGQILQKTVAATGCEIDGKVYRVNQLVRPASGPCMQCRCEYGGIMKCDPKDCQPQ
APLLLRLNKEFFRK
Download sequence
Identical sequences A0A087SVQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]