SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087T497 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087T497
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.7e-29
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087T497
Sequence length 78
Comment (tr|A0A087T497|A0A087T497_9ARAC) Signal recognition particle protein {ECO:0000313|EMBL:KFM59936.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_21230 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MPYCSTWEEFAKAAERLYITDPMKVRFTMKYRHCDGKLITKITDNHTCLMYLTEHTQDVK
KIEKLTSQLMRHMASKEK
Download sequence
Identical sequences A0A087T497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]