SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087THL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087THL1
Domain Number 1 Region: 292-422
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-42
Family Regulator of G-protein signaling, RGS 0.0000288
Further Details:      
 
Domain Number 2 Region: 18-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-26
Family DEP domain 0.0076
Further Details:      
 
Domain Number 3 Region: 223-282
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000575
Family Transducin (heterotrimeric G protein), gamma chain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087THL1
Sequence length 489
Comment (tr|A0A087THL1|A0A087THL1_9ARAC) Uncharacterized protein {ECO:0000313|EMBL:KFM64600.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_23802 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MTIGFNIMDEVRDCSRESVFTRMEQLICEMQHPETGVPVRSQKLFLTTIPCAFLGYDLVE
WLMDHLNIEEMVSLCPLAEAVHLANLLCQHGYFFPVGDTRSLAIRDDSTLYRFQAPYFWP
SHHQPDNTDYAIYLLKRSMKNKQKHSLEEYEQEALARLKKLLCHKWDFITLQAEEQVNLA
KDKKKGDKIVLDSQEKAYWRVHRPPPGAISCLEKTPLANRKVKKKTIDDLKRQRALLQKS
LSKPVVKVSQITESLISYCQDYIEFDSFIAGVLPSNPWISDDTTLWALNNREVDVPTEQR
VKLWAISLEALLNDPTGIKEFERYLRTEYSHENILFWKAVQSLRRGGKADIEKKVHAIYN
EFLAPNAPCEVNLDSCTVECVQEAMKNPSRYTFDAALLHVYSLMEQDTYPRFLRSPYYRN
LLLNSLHPAQKKKFFNFGAGVRKRMVSAGGKRRTNPSHLSGSSVDLTHMSHSLEMEEPSM
SSRHSHSTS
Download sequence
Identical sequences A0A087THL1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]