SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087TK39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087TK39
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000144
Family Hormone receptor domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087TK39
Sequence length 35
Comment (tr|A0A087TK39|A0A087TK39_9ARAC) Corticotropin-releasing factor receptor 2 {ECO:0000313|EMBL:KFM65478.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_16139 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MEYLNRVPYDTTQNATRECYDNGTWALRSDYSKCR
Download sequence
Identical sequences A0A087TK39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]