SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087TL61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087TL61
Domain Number 1 Region: 191-239
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000706
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.059
Further Details:      
 
Domain Number 2 Region: 70-143
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000409
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087TL61
Sequence length 239
Comment (tr|A0A087TL61|A0A087TL61_9ARAC) Terminal uridylyltransferase 7 {ECO:0000313|EMBL:KFM65850.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_23994 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MDPHLYSPFSSSILSEVWKKAMLSLNEQHNSKTASAKHKGYCVAARCAHIEALSDCLKGI
EKERLISNDTAEKVLKDLNKVIKRKFPGISVTLYGSYSCDLAVSTSNLNFALQTNCSIKN
PILFEIRKCLAKELTKYDVLPFDEEMSVRKSKICFIEPYTRVACEMMYLGKHTEHVHKMS
GFLKALCSFDHRIKTLFIAARIWAEVCSIHESEDGKLPPVAFNLMVVYFLQQLEKPLLP
Download sequence
Identical sequences A0A087TL61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]