SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087TNX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087TNX1
Domain Number 1 Region: 117-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-37
Family cAMP-binding domain 0.00000219
Further Details:      
 
Domain Number 2 Region: 247-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-32
Family cAMP-binding domain 0.00000274
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 6.02e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087TNX1
Sequence length 380
Comment (tr|A0A087TNX1|A0A087TNX1_9ARAC) cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:KFM66810.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_02794 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MASHSSDEEQSLRECEAYVQRHNIQRLLKDCIVQLCVRRPENPVSFLREYFQKLEREAAA
SAKNQQKNLNATSPCDERDDDICGTPNMAPAQRVRRGAVSAETYSEEDATTYVKKVVPKD
YKTMTALSKAIEKNVLFAHLDDTERSDIFDAMFPVVHSAGETIIQQGDQGDNFYVIDQGE
VEVFVNGQLVTTIGEGGSFGELALIYGTPRAATVRAKTDCKLWAIDRDTYRRILMGSTIR
KRKMYQEFLSKVSVLESLDEWERLTVADALEPMQFNDGDVIVEQGQPGDDFFIIEDGTAV
VLQRRSESEPQVEVGHLGPSDYFGEIALLLDRPRAATVKAKGPLKCIKLDRARFERILGP
CADILKRNMTHYNSLISLSV
Download sequence
Identical sequences A0A087TNX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]