SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087TPM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087TPM1
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000759
Family YWTD domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087TPM1
Sequence length 119
Comment (tr|A0A087TPM1|A0A087TPM1_9ARAC) Prolow-density lipoprotein receptor-related protein 1 {ECO:0000313|EMBL:KFM67060.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_15569 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MSLASDKKTCYKNEKVLLFSRQSEIRGVELTMPYYNMIPPVSVPKVLKVNQIDFVASRHQ
IYWSDTDLSEVKRANLSGSSVETLIDIVLENPTGFAVDWASQNLFVSSLGASKRIIASN
Download sequence
Identical sequences A0A087TPM1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]