SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087TZW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087TZW0
Domain Number 1 Region: 816-940
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-39
Family Regulator of G-protein signaling, RGS 0.0000772
Further Details:      
 
Domain Number 2 Region: 8-93
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-22
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 286-404
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000439
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087TZW0
Sequence length 985
Comment (tr|A0A087TZW0|A0A087TZW0_9ARAC) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFM70649.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_24683 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MHQHRRRKKRPSYGVRTVEISRGKNGFGFTISGQAPCILSCIITGSPAEKAGLRPGDFLI
AVNGQNVSKAPHDDVVRLIGNSNGVLKLQIAENYYSDSSEEEFISIVKLRPKYPNKVRNR
QHQSSVSRAEKVVQDLQTGALFVDHIHGSSVVEIPQKQRNSKGQSVGLAPSSRSNKLLLD
LILQQRIQDASNRHSLQNIPLQQTTCVPSVSSSEKIRQVCPKKKENKVIKSRSHPEHLNT
STSADEVFHSIFTEQDLNNILYPALFASQNNEEQKGNEEQAVLKAVVGYLGTIEMPKEPQ
LPNSRLQTIRNCIRRLRVEKKVHTLVLMSVFPESIILINPQGVTLAEFSADKITFSGVYS
DDKKFFGLVTNHGISSDELSEGSQEDPGSVSSSCHVFMVDPKLTPHHQHMKRAKAFHITC
TSDPVTNKCKEFPESADSILQAVVGLYRSKLGFSNEFVHGLEFHVNMSPQPSNTSSNSSN
SDSGIGFRDEGNASDRVFVVDVDNYHQYSTNSLDRQAFTTPGFGLLESPLRSFSLSQDSP
MLASKVGNHSQSNELKAGSNQTSCQFDRLTVRAMPDPVGFERNCNSYNSEHIDQSNSSNT
RSSLHNLMQSKQDVSGSVKGSQNVNLLTSSTGENLLNGNVITDSQKNASSVEVQINKLSP
KVYGLNFPLKSVDEMGFCNTSADSVGWECTSCSTEELQSQSRHLMLPENQDTTEQEEDGS
QDVHPSTQDDDSERESEISGMEHGLEVTRKWARTSSLRRHLGRKRSLHRSTHEAGTVSDG
ELASGKVSTSSSLLALDHLSDTSHRSSCASERPIDVGRVGSWAAGFNVLLEDPAGLHTFS
EFLKKEFSQENITFWIACERYRQLKDQALMAQMAKEIYTKHLCIGAHEPVNVDSHARQVA
QEGLDSPTPELFLPAQKQIFNLMKFDCYQRFLKSTMFKECMLREMQGQPLLYPGQVLESG
NSCENDKQKVSVELKKRKSLIPWHK
Download sequence
Identical sequences A0A087TZW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]