SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087U1Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087U1Z3
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.73e-33
Family Poly(A) polymerase, PAP, N-terminal domain 0.049
Further Details:      
 
Domain Number 2 Region: 145-251
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.14e-17
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087U1Z3
Sequence length 255
Comment (tr|A0A087U1Z3|A0A087U1Z3_9ARAC) Terminal uridylyltransferase 4 {ECO:0000313|EMBL:KFM71382.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_14928 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MKKVDRVLMEIYEDCILPEKQIDERKAFVHNLEVYVKKVFRYAQLTLFGSSVNGFGFKAS
DLDICLTLKNRRKENISPRQILQILRNHLRKNKEFKNIWVVWGAQIPIIKFYCIPRKFRC
EISLYNILAVHNSVLLRTYSLLDERCKILGCALKLLAKKASIAETVSRTLSSYSYILMVI
HYLQQVKPPVLPVLPILDQNIFEESLDIPTEIAEKHDWLCKDIQILKALFNKESRNESTV
GQLWLGLLKFYIQIK
Download sequence
Identical sequences A0A087U1Z3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]