SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087U3J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087U3J0
Domain Number 1 Region: 64-120
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-20
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000249
Family SH2 domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087U3J0
Sequence length 122
Comment (tr|A0A087U3J0|A0A087U3J0_9ARAC) Protein vav {ECO:0000313|EMBL:KFM71929.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_11736 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MRVCSADNGQQFYLSETKYFKSIVELINWYKENSLAESFNGLNVTLMIPYKKAIAGFNNE
SIIGYAEALYDFQGNAPNMLSLHKGDRVAVLSKAGNQKGWWKGQIDENVGYFPYSYVKEI
FD
Download sequence
Identical sequences A0A087U3J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]