SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087U7M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087U7M6
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Prefoldin 2.62e-22
Family Prefoldin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087U7M6
Sequence length 124
Comment (tr|A0A087U7M6|A0A087U7M6_9ARAC) Prefoldin subunit 1 {ECO:0000313|EMBL:KFM73365.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_02487 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MAGKGVDLELKKAFQELQTKMLDTTQKLKIANLQIDSFTKAIQYAELTQKELKSFPENTS
MYNGIGRMFVHADSDDINEMLSKKIQTSQDKIKELEASKVFLECSMKDSEENLRELIASK
QRDR
Download sequence
Identical sequences A0A087U7M6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]