SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087U8K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087U8K1
Domain Number 1 Region: 6-21,204-284
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-19
Family Regulator of G-protein signaling, RGS 0.0043
Further Details:      
 
Domain Number 2 Region: 290-337
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000707
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087U8K1
Sequence length 340
Comment (tr|A0A087U8K1|A0A087U8K1_9ARAC) A-kinase anchor protein 10, mitochondrial {ECO:0000313|EMBL:KFM73690.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_21025 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MDAHRAKHLVKFWLEAESFRISLETKLKSENKKITLLQTCDVNISASSSGNSSYVSDKSE
EVFQSSSHATCSSSKVLDHKVGIYEKNLHYPNLKTLAVNINDNNTVPLHLSHNETVKFDF
TCENPSDDKPSKIVQQSSSIDSGCEEKPKELTFECSLTDSKSVPVNIGKNNTKLSSIKKE
WDAENEEVLGKDNQRSELFKGGLVRLETSIEQDANSIYCKYIALDASFPVGVSDELRTAI
KNEIFNSSGDIDPQCFVPAQDFVFKRMEKEYFPNFLRSNFHCKHQIDVLTSGNVFLADVL
YNDSALFYFMEFMEQEGVRHLVDFLLMADNFQKHLLSHQG
Download sequence
Identical sequences A0A087U8K1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]