SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UG64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UG64
Domain Number 1 Region: 21-77
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.00000000000000275
Family Nicotinic receptor ligand binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087UG64
Sequence length 78
Comment (tr|A0A087UG64|A0A087UG64_9ARAC) Gamma-aminobutyric acid receptor alpha-like protein {ECO:0000313|EMBL:KFM76353.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_24360 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MKSTNKSSDASTTLELSRNISTVLEHLLRNYDNRQRPDHGGSPTIVTTNFLIRSMGPISE
LDMEYSMDCYFRQKWTDR
Download sequence
Identical sequences A0A087UG64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]