SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UI15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UI15
Domain Number 1 Region: 183-433
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-74
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 32-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-35
Family Regulator of G-protein signaling, RGS 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087UI15
Sequence length 440
Comment (tr|A0A087UI15|A0A087UI15_9ARAC) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_06489 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MELENIVANTVYLKAREGGADSNKGKSKKWKKILQFPHISHCIDLKNKIDCRYSYVVEQQ
PIGHQLFRQFCETKPHYSKCNDFLDIVDIYEVQLDEDRADVAQEVFSKYLSKDSSEFVDV
VNEDLIERCHANLQTASRDLFTECARAVKEFLSREPFKEFENSMYFHRYLQWKWLESQPV
TAKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKNILQKI
NSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFDLERARFYAAEVTQGLE
HLHAQGIVYRDLKPENILLDDHGHVRISDLGLATEILEGEMVRGRVGTVGYMAPEVIDNE
KYTFSPDWFSLGCFIYEMIEGQAPFRARKEKVKREEVERRVKEDKERYSSKFSDDAKSLC
HELLKKSVKERLGCNNGRYG
Download sequence
Identical sequences A0A087UI15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]