SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UL69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UL69
Domain Number 1 Region: 37-89
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000275
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087UL69
Sequence length 99
Comment (tr|A0A087UL69|A0A087UL69_9ARAC) Abnormal spindle-like microcephaly-associated protein-like protein {ECO:0000313|EMBL:KFM78108.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_21972 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MNNLKLKVECAAFNALRNHTSSEVCDADFIDSKLYKENEVLQLLLQWCQNVCAHYDYKVC
NFTSSFSDGQALCLLLHHYHPNILPFDSIKRMTVSSYYE
Download sequence
Identical sequences A0A087UL69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]