SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UPQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UPQ8
Domain Number 1 Region: 149-205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.1e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 273-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000863
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 3 Region: 86-137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000116
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 30-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087UPQ8
Sequence length 495
Comment (tr|A0A087UPQ8|A0A087UPQ8_9ARAC) Semaphorin-5B {ECO:0000313|EMBL:KFM79347.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_25138 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MACTTAPHRNPLSSFWVQNPIRCPKPDAPVDGDWGDWSKWAPCSQIKKDSSNDGCLCRQR
FCDRPSPTNGGKKCDGISVQVTNCTVHGQWTEWSAWSACSQSCGVAIKMRRRTCGNPAPS
YGGHNCVGPERDEMYCATNPPCPVYTRLPIHGHWSEWNSWSECSSPCGGGIQTRERRCDD
PMPQYGGKECIGCHQDFRICNTHMCPEHRKSSPWTPWMMVNFTKDGFFQQRFRAICRANV
VDVNDIRLGHLKKEERYCLEGSSGCSDPGSKNIDADWSEWSEWSSCSVTCGTGVQYRERT
CDIPSLLGNGAECKGSSRIERQCELPPCDESEGWDEWTVWSLCDYRQEQHRQRKCRIDVP
SSKYCSGASRETRLCVNQVEGVEYGVGESHAAEEDGIHVEHVIVAFIGGLVTGLALGTFG
MYLFKQRKIHDLPRLTPRGTDANLYISNTEWKAARPLTESPLKVPQKEATIKRNCNGTLT
RNLRTPLYSEESYCT
Download sequence
Identical sequences A0A087UPQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]