SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UT09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UT09
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily DEATH domain 1.74e-16
Family DEATH domain, DD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087UT09
Sequence length 190
Comment (tr|A0A087UT09|A0A087UT09_9ARAC) Myeloid differentiation primary response protein MyD88 {ECO:0000313|EMBL:KFM80498.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_04955 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MEEGTFNQTPITALSLRTRMKIALFLNPPRELLSHEKVPGDYRGLAELMQFAYIEIQNFG
TYQEPTMKLLDTWGKRQGATFGKLMELLQELQRYDLLAQVVPLLEEDAAAYQRRIHMQRN
GQHLIQDPEVTSGDSLNSSQYLTVDDFLSGESTLYHAFMLHSDAPEDVSFAIELTRKLES
EGMKIFLRNR
Download sequence
Identical sequences A0A087UT09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]