SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UVP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UVP4
Domain Number 1 Region: 22-129
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.4e-28
Family Cystatins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087UVP4
Sequence length 136
Comment (tr|A0A087UVP4|A0A087UVP4_9ARAC) Cystatin {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_03668 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MEKFAATIFLHLFCGTLAMMTGGWKEIDKNSPEVAKHAEFATNKISASSNSLYHLKPVEI
LKAESQVVSGINYRMTIKMAPTECKKNDSNNLDLSQCELVKCEAPMICNVTVWVQAWREN
GTKLTNSFCEAGERPC
Download sequence
Identical sequences A0A087UVP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]