SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UY03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UY03
Domain Number 1 Region: 250-370
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.34e-23
Family Regulator of G-protein signaling, RGS 0.0012
Further Details:      
 
Domain Number 2 Region: 484-577
Classification Level Classification E-value
Superfamily PX domain 0.00000000523
Family PX domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087UY03
Sequence length 577
Comment (tr|A0A087UY03|A0A087UY03_9ARAC) Sorting nexin-25 {ECO:0000313|EMBL:KFM82242.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_15468 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MLFTFRNRCRKMDDVKLFTSDFVSIVTDHLQCIKGAIINPAEKIVPYKVYSFLSYKEAEL
DYLREICEFLLITLLPPEYAKNTALRCLLREVFAVTVFYPVIDKLCDPEIINKKLISYLR
QQQLEAEKHSRTYAYAETYEDFIKMIQECNNIEDLQRMRYYIVTEIMQATTMSNLKRSKG
MDADKEFNPQKTSKGDLLQSRNLSRYLNQLRFAKTQCEKRLKALGGPDYLSSPRMGNDSP
FKENSYMPGQKVLSMSVIMQSSFCRRHFSKFLQKEEVHSLLGFWEAVEDMKHADKDMWHK
LGNDIVQMYIHNQSSGVRLNKNTLKGIEEFMMANKGPDAFFQAQEEIYKVLEERYYASFI
VSDVYHKMLSDVDKQGIDFMQELLDEAEEEVEIPHEDEEVEKLSETSDISVFDHSSYARS
QLKVLTEKISYKKQALHALRNNPKCDKKVISKMENEIDDLVQEQNMLKNHIEKTELWIEY
LGVWQATIMEAMEKKENDKLVPYFVIQVHLANDATYVPNKMAGWVVSRSLSAFHSLHQKL
VPAAYWLKKIELPTKPRFKSLDKNYLEKAKNSLQTFL
Download sequence
Identical sequences A0A087UY03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]