SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087V2J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087V2J4
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.38e-22
Family Cystatins 0.0000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087V2J4
Sequence length 77
Comment (tr|A0A087V2J4|A0A087V2J4_BALRE) Cystatin-B {ECO:0000313|EMBL:KFO06836.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_08915 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
KVKPQLEEKEGKTFDVFTAVEFKTQVVAGTNYFIKVHVGNDEFMHLRVFRSLPHESKSLS
LHSYQSSKTKHDELAFF
Download sequence
Identical sequences A0A087V2J4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]