SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087V4Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087V4Z3
Domain Number 1 Region: 200-287
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.53e-21
Family HSP40/DnaJ peptide-binding domain 0.00087
Further Details:      
 
Domain Number 2 Region: 117-199
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.62e-18
Family HSP40/DnaJ peptide-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 2-70
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000123
Family Chaperone J-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087V4Z3
Sequence length 294
Comment (tr|A0A087V4Z3|A0A087V4Z3_BALRE) DnaJ subfamily B member 13 {ECO:0000313|EMBL:KFO07685.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_09317 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
SYRKLALKNHPLKCKEPWVPKRFRQLAEAYDVLSDPMKKGIYDKFGEEGLKGGIPLEFGG
ENPWTAGYVFHNNPDKVFKEFFGGDNPFAEFFAEDGSELVLPFGGLRGRGAMKQDPPIVR
DLYLSLEDLFYGCTKKIKISRRVMNEDGQTSTIRDKILTIDVQPGWKQGTRITFEKEGDQ
GPNVIPADITFVVQEKIHPRFKRADNNLTYVATIPLGKALIGCTVDVRTLDGRLLNIPIN
DIVDPKYCKVVPGEGMPLLQDPGRKGDLLIYFNICFPKKLTPEKKLLLKSALLS
Download sequence
Identical sequences A0A087V4Z3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]