SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087V580 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087V580
Domain Number 1 Region: 83-143,263-346
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-33
Family Regulator of G-protein signaling, RGS 0.0061
Further Details:      
 
Domain Number 2 Region: 341-479
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.94e-28
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087V580
Sequence length 632
Comment (tr|A0A087V580|A0A087V580_BALRE) Uncharacterized protein {ECO:0000313|EMBL:KFO07772.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_12392 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
VKGKEQEKTTDVKAIKTPVPVHSPQRSTRNHALLEAAGPSHVAINAISANMDSFSSSRTA
ALKKQPSHMEAAHFGDLGRSCLNYQAQETKSSLSKTLEQVLQDNVALPYFIQFMELRRME
HLVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKQQEIASSSPTGLLEERLED
SSTVRLLRTKPVASDKNNRTSNSQNHVLSGQESDNTGVLGLRKSETGTYSVPADQQESSK
LTVSNRNSPSSALKDLSGKLMKSIERDAVSTFTKYISPDAAKPIPITEAMRNDIVAKICG
EDGQVDPNCFVTAQSIVFNAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESAL
FYFSEYMEKEEAVNVLQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHP
LGFDDSVRLEIESNICREGGPLPNCFTTPLRQAWTTMETVFLPGFLSSNLYYKYLNDLIN
SVRGDDFPGGNIALSIHGPGSSPDSDSIGGPDGSASQSNVKKANVKILKNFDEAIIVDAA
SLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVKKSKGSMFSQAMKKWVQGNTDEA
QEEMAWRIAKMIVNDVMQQAQCEQPLEKVTKV
Download sequence
Identical sequences A0A087V580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]