SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VAB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VAB8
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.97e-62
Family T-box 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087VAB8
Sequence length 165
Comment (tr|A0A087VAB8|A0A087VAB8_BALRE) T-box transcription factor TBX18 {ECO:0000313|EMBL:KFO09560.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_02214 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
RRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIH
PDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPVK
PIPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRD
Download sequence
Identical sequences A0A087R8L3 A0A087VAB8 A0A091F5K9 A0A091GWB6 A0A091JWG4 A0A091N108 A0A091NFL4 A0A091PP13 A0A091Q9N6 A0A091RDK5 A0A091TCN2 A0A091UB10 A0A091XDZ9 A0A093CUR9 A0A093FHT0 A0A093I8S3 A0A093LUQ2 A0A093RRR4 A0A099ZCH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]