SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VBF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VBF5
Domain Number 1 Region: 3-380
Classification Level Classification E-value
Superfamily Sema domain 1.44e-123
Family Sema domain 0.000000261
Further Details:      
 
Domain Number 2 Region: 727-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.19e-17
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 673-724
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.89e-16
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 485-535
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000419
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 376-428
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000296
Family Plexin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 540-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 7 Region: 786-831
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 429-482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000549
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087VBF5
Sequence length 964
Comment (tr|A0A087VBF5|A0A087VBF5_BALRE) Semaphorin-5A {ECO:0000313|EMBL:KFO09947.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_10841 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
QEECQNYIRVLLVGGNHLFTCGTNAFTPICTNRTLSNLTEIHDQISGMARCPYSPQHNST
ALLTSSGELYAATAMDFPGRDPAIYRSLGALPPLRTAQYNSKWLNEPNFVSSYDIGNFTY
FFFRENAVEHDCGKTVFSRAARVCKNDIGGKFVLEDTWTTFMKARLNCSRPGEIPFYYNE
LQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAITQAFNGPFKYQENSRSAWLPYPN
PNPNFQCGTMDQGLYVNLTERNLQDAQKFFLMHEVVQPVIPIPYFMEDNSRFSHVVVDVV
QGKDMLFHIIYLATDYGTIKKVLAPMNQTSSSCLLEEIELLPKSQREPIRSLQILHSQSV
LFVGLQEHVIKVPLKRCPFYKTYSACIGSQDPYCGWDMVMKKCTTLEESLSMSQWEQSIT
VCPVRNLTVDGHFGNWSQWKPCTHTDGASVGSCLCRTRVCDSPAPQCGGWLCEGPTMEIA
NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLC
PPHVFWTGWGPWERCTAQCGGGIQARRRMCENGPDCPGCSVEYQPCNTNACPELKKTTPW
TPWTPVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSG
DFLHSGRYSAHTINGAWSPWSPWSQCSRDCSRGIRNRKRVCSNPEPKYGGLPCLGPSLEY
QECNILPCPVDGGWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALC
NTQPCPDSWSEWSEWSDCDSSGFQFRVRQCIILFPVGSQCTGNTTETRACALDSNVIPEI
SVARSSSIEEKRCGEFNMFHMITVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVS
PAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTAKTYSNTYFTDFNN
YDEY
Download sequence
Identical sequences A0A087VBF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]