SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VQH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VQH3
Domain Number 1 Region: 154-256
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 39-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000628
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 3 Region: 111-153
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000191
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087VQH3
Sequence length 299
Comment (tr|A0A087VQH3|A0A087VQH3_BALRE) Kazal-type serine protease inhibitor domain-containing protein 1 {ECO:0000313|EMBL:KFO14865.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_12827 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
LKMKHPMVTAVLVVLVQVSQSFPALYHRGWWRLLREGDSCGKCDLALCSEPKDCPAGTVL
DRCGCCPECGNVEGQICDLDQGNHFYGQCGENLECRLDADEARFGEVPEPQCVCKSQESI
CGPEGKTYENICQFNKAYAMKRNISMKHKGPCESAPVISMPPQDVQNFTGNDVIFGCEVS
AYPMPHLEWKKKGNKMFLPGDDAHISVQARGGPQKYGVTGWLQIQGLKKSDEGVYICHTK
NKYGATYASARLKVIDGSSPAFAYTAGSRSASYSIEYGDYYDHSDDEDDEEYESGDYEN
Download sequence
Identical sequences A0A087VQH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]