SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087W1H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087W1H8
Domain Number 1 Region: 192-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-85
Family Protein kinases, catalytic subunit 0.000000000065
Further Details:      
 
Domain Number 2 Region: 30-187
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-35
Family Regulator of G-protein signaling, RGS 0.00000172
Further Details:      
 
Domain Number 3 Region: 607-725
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000315
Family Pleckstrin-homology domain (PH domain) 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087W1H8
Sequence length 816
Comment (tr|A0A087W1H8|A0A087W1H8_ECHMU) Beta adrenergic receptor kinase {ECO:0000313|EMBL:CDI98405.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000225500 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MADLEAVLADVSYLMAMEMSKSTPAARASKKITLPDPSIRSVMMKYMEKRGDLTFDKIFN
QRLGYLIFKDYCLNYHEEPVPQIRFYEEIKKLESLETDEERIALGKEIYDQFIMKDLLSQ
SHEFSKETVARVLELLTSAQRTRILPPDTFSPYLQEICESIRGDIFDAFIRSPRFTRFCQ
WKNLELNLNLTANDFSVHRIIGRGGFGEVYGCRKTDTGKMYAMKCLDKKRIKMKGGESLA
LNERAMLSLVSTGEGCPFIVCMTYAFQTPEKLCFILDLMNGGDLHYHLTQHNVFSESEVR
FYAAEVVLGLEHMHNRFIVYRDLKPANILLDEYGHIRISDLGLACDFSRKRPHASVGTHG
YMAPEVLQRGRSYDSSADWFSLGCMLYKLLRGHSPFRHHKVRDKHEIDRMTMTMDIELPE
DLSPEMYSLLSKLLARDVDCRLGCMGRGSLEVREHEFFKDIDWQLAYHRKYPPPLIPPRG
EVNAADAFDIGSFDEEDTKYIKLTESDLEPYKNFSLVVSERWQLEIAETVFDVINQETDR
IENKRRSKLQQQQQQGSQNSASSSSTTAPTSNTSPFTPSSSSQKALSTSSSECSTGDISV
STDPHSTQLNSDCIVEGDVLKLVGPFFQTWQRKFLRLFPNRLEMYSKSRDGTVVKKGVEL
ISMVDIREISRDFQRMYKMDNCLTITLKNDSKIVITSSDKVLITQWKEEIEEAFQISNEL
ISNLNKKAHKDLGTRTPTRSKAAAASESGGSQSLVRQTSVPSMGLQKSLTKLYSFTTLSG
GISGHFERSPARSMVGPIAEGDGETREVHQSSRDDA
Download sequence
Identical sequences A0A087W1H8
EmuJ_000225500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]