SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WQW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WQW8
Domain Number 1 Region: 96-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000275
Family Fibronectin type I module 0.00014
Further Details:      
 
Domain Number 2 Region: 53-93
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000942
Family Fibronectin type I module 0.00019
Further Details:      
 
Weak hits

Sequence:  A0A087WQW8
Domain Number - Region: 139-160
Classification Level Classification E-value
Superfamily FnI-like domain 0.000434
Family Fibronectin type I module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087WQW8
Sequence length 160
Comment (tr|A0A087WQW8|A0A087WQW8_MOUSE) Fibronectin {ECO:0000313|Ensembl:ENSMUSP00000140372} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Fn1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKHRCHEGGQSY
KIGDKWRRPHETGGYMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGW
MMVDCTCLGEGNGRITCTSRNRCNDQDTRTSYRIGDTWSK
Download sequence
Identical sequences A0A087WQW8
ENSMUSP00000140372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]