SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WRB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WRB0
Domain Number 1 Region: 47-117
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.67e-28
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087WRB0
Sequence length 130
Comment (tr|A0A087WRB0|A0A087WRB0_MOUSE) Regulator of G-protein-signaling 2 {ECO:0000313|Ensembl:ENSMUSP00000140548} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MKRTLLKDWKTRLSYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKY
GLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEVRRQA
PQITFNTVET
Download sequence
Identical sequences A0A087WRB0
ENSMUSP00000140548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]