SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WSH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WSH2
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.97e-41
Family Regulator of G-protein signaling, RGS 0.0000278
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-25
Family DEP domain 0.016
Further Details:      
 
Domain Number 3 Region: 214-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 5.1e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087WSH2
Sequence length 437
Comment (tr|A0A087WSH2|A0A087WSH2_MOUSE) Regulator of G-protein-signaling 6 {ECO:0000313|Ensembl:ENSMUSP00000141044} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs6 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIF
PISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAEN
LARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEM
DIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPIRKTTKDDIRKQITFLNAQIDRH
CLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPWISDDITLWDIEMSKEPSQQRVKRWGF
SFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPG
APSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKK
KGKSLAGKRLTGLMQSS
Download sequence
Identical sequences A0A087WSH2
ENSMUSP00000021642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]