SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WXC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WXC7
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily PX domain 3.92e-17
Family PX domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087WXC7
Sequence length 195
Comment (tr|A0A087WXC7|A0A087WXC7_HUMAN) Zinc finger CCHC domain-containing protein 2 {ECO:0000313|Ensembl:ENSP00000480901} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZCCHC2 OC=Catarrhini; Hominidae; Homo.
Sequence
MQNNESSLIEQAPIPQDGLTVAPHRAQREAVHIEKIMLKGVQRKRADKYWEYTFKVNWSD
LSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQGSLKREERRHPDLEPILRQLF
SSSSQAFLQSQKVHSFFQSISSDSLHSINNLQSSLKTSKILEHLKEDSSEASSQEEDVLQ
HAIIHKKHTGKSPIV
Download sequence
Identical sequences A0A087WXC7 A0A2J8ND85
ENSP00000480901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]